SCOPe 2.02: Domain d1fcva_: 1fcv A:

Lineage for d1fcva_ (1fcv A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.9: Bee venom hyaluronidase [69387] (2 proteins)
   distorted barrel lacks the second strand

6. Protein Bee venom hyaluronidase [69388] (1 species)

7. Species Honeybee (Apis mellifera) [TaxId:7460] [69389] (3 PDB entries)

8. Domain d1fcva_: 1fcv A: [65008]

Details for d1fcva_

PDB Entry: 1fcv, 2.65 Å

PDB Description: crystal structure of bee venom hyaluronidase in complex with hyaluronic acid tetramer

PDB Compounds: (A:) Hyaluronoglucosaminidase

SCOPe Domain Sequences for d1fcva_:

Sequence; same for both SEQRES and ATOM records:

>d1fcva_ c.1.8.9 (A:) Bee venom hyaluronidase {Honeybee (Apis mellifera) [TaxId: 7460]}
efnvywnvptfmchkyglrfeevsekygilqnwmdkfrgeeiailydpgmfpallkdpng
nvvarnggvpqlgnltkhlqvfrdhlinqipdksfpgvgvidfeswrpifrqnwaslqpy
kklsvevvrrehpfwddqrveqeakrrfekygqlfmeetlkaakrmrpaanwgyyaypyc
ynltpnqpsaqceattmqendkmswlfesedvllpsvylrwnltsgervglvggrvkeal
riarqmttsrkkvlpyywykyqdrrdtdlsradleatlrkitdlgadgfiiwgssddint
kakclqfreylnnelgpavkrial

Timeline for d1fcva_:

• d1fcva_ first appeared in SCOP 1.59
  
• d1fcva_ appears in SCOPe 2.01
  
• d1fcva_ appears in SCOPe 2.03
  
• d1fcva_ appears in the current release, SCOPe 2.08