Lineage for d1fcva_ (1fcv A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173209Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 173872Family c.1.8.9: Bee venom hyaluronidase [69387] (1 protein)
  6. 173873Protein Bee venom hyaluronidase [69388] (1 species)
  7. 173874Species Honeybee (Apis mellifera) [TaxId:7460] [69389] (3 PDB entries)
  8. 173877Domain d1fcva_: 1fcv A: [65008]

Details for d1fcva_

PDB Entry: 1fcv (more details), 2.65 Å

PDB Description: crystal structure of bee venom hyaluronidase in complex with hyaluronic acid tetramer

SCOP Domain Sequences for d1fcva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fcva_ c.1.8.9 (A:) Bee venom hyaluronidase {Honeybee (Apis mellifera)}
efnvywnvptfmchkyglrfeevsekygilqnwmdkfrgeeiailydpgmfpallkdpng
nvvarnggvpqlgnltkhlqvfrdhlinqipdksfpgvgvidfeswrpifrqnwaslqpy
kklsvevvrrehpfwddqrveqeakrrfekygqlfmeetlkaakrmrpaanwgyyaypyc
ynltpnqpsaqceattmqendkmswlfesedvllpsvylrwnltsgervglvggrvkeal
riarqmttsrkkvlpyywykyqdrrdtdlsradleatlrkitdlgadgfiiwgssddint
kakclqfreylnnelgpavkrial

SCOP Domain Coordinates for d1fcva_:

Click to download the PDB-style file with coordinates for d1fcva_.
(The format of our PDB-style files is described here.)

Timeline for d1fcva_: