Lineage for d1fcva_ (1fcv A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) 
Family c.1.8.9: Bee venom hyaluronidase [69387] (1 protein) Protein Bee venom hyaluronidase [69388] (1 species) Species Honeybee (Apis mellifera) [TaxId:7460] [69389] (3 PDB entries) 
Domain d1fcva_: 1fcv A: [65008]
Details for d1fcva_
PDB Entry: 1fcv (more details), 2.65 Å
PDB Description: crystal structure of bee venom hyaluronidase in complex with hyaluronic acid tetramer
SCOP Domain Sequences for d1fcva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fcva_ c.1.8.9 (A:) Bee venom hyaluronidase {Honeybee (Apis mellifera)}
efnvywnvptfmchkyglrfeevsekygilqnwmdkfrgeeiailydpgmfpallkdpng
nvvarnggvpqlgnltkhlqvfrdhlinqipdksfpgvgvidfeswrpifrqnwaslqpy
kklsvevvrrehpfwddqrveqeakrrfekygqlfmeetlkaakrmrpaanwgyyaypyc
ynltpnqpsaqceattmqendkmswlfesedvllpsvylrwnltsgervglvggrvkeal
riarqmttsrkkvlpyywykyqdrrdtdlsradleatlrkitdlgadgfiiwgssddint
kakclqfreylnnelgpavkrial
SCOP Domain Coordinates for d1fcva_:
Click to download the PDB-style file with coordinates for d1fcva_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fcva_:
- d1fcva_ is new in SCOP 1.59
- d1fcva_ appears in SCOP 1.61
- d1fcva_ appears in the current release, SCOPe 2.08
View in 3D