Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.9: Bee venom hyaluronidase [69387] (2 proteins) distorted barrel lacks the second strand automatically mapped to Pfam PF01630 |
Protein Bee venom hyaluronidase [69388] (1 species) |
Species Honeybee (Apis mellifera) [TaxId:7460] [69389] (3 PDB entries) |
Domain d1fcva_: 1fcv A: [65008] |
PDB Entry: 1fcv (more details), 2.65 Å
SCOPe Domain Sequences for d1fcva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fcva_ c.1.8.9 (A:) Bee venom hyaluronidase {Honeybee (Apis mellifera) [TaxId: 7460]} efnvywnvptfmchkyglrfeevsekygilqnwmdkfrgeeiailydpgmfpallkdpng nvvarnggvpqlgnltkhlqvfrdhlinqipdksfpgvgvidfeswrpifrqnwaslqpy kklsvevvrrehpfwddqrveqeakrrfekygqlfmeetlkaakrmrpaanwgyyaypyc ynltpnqpsaqceattmqendkmswlfesedvllpsvylrwnltsgervglvggrvkeal riarqmttsrkkvlpyywykyqdrrdtdlsradleatlrkitdlgadgfiiwgssddint kakclqfreylnnelgpavkrial
Timeline for d1fcva_: