SCOPe 2.04: Domain d1fcua_: 1fcu A:

Lineage for d1fcua_ (1fcu A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.9: Bee venom hyaluronidase [69387] (2 proteins)
   distorted barrel lacks the second strand
   automatically mapped to Pfam PF01630

6. Protein Bee venom hyaluronidase [69388] (1 species)

7. Species Honeybee (Apis mellifera) [TaxId:7460] [69389] (3 PDB entries)

8. Domain d1fcua_: 1fcu A: [65007]

Details for d1fcua_

PDB Entry: 1fcu, 2.1 Å

PDB Description: crystal structure (trigonal) of bee venom hyaluronidase

PDB Compounds: (A:) Hyaluronoglucosaminidase

SCOPe Domain Sequences for d1fcua_:

Sequence; same for both SEQRES and ATOM records:

>d1fcua_ c.1.8.9 (A:) Bee venom hyaluronidase {Honeybee (Apis mellifera) [TaxId: 7460]}
efnvywnvptfmchkyglrfeevsekygilqnwmdkfrgeeiailydpgmfpallkdpng
nvvarnggvpqlgnltkhlqvfrdhlinqipdksfpgvgvidfeswrpifrqnwaslqpy
kklsvevvrrehpfwddqrveqeakrrfekygqlfmeetlkaakrmrpaanwgyyaypyc
ynltpnqpsaqceattmqendkmswlfesedvllpsvylrwnltsgervglvggrvkeal
riarqmttsrkkvlpyywykyqdrrdtdlsradleatlrkitdlgadgfiiwgssddint
kakclqfreylnnelgpavkrial

Timeline for d1fcua_:

• d1fcua_ first appeared in SCOP 1.59
  
• d1fcua_ appears in SCOPe 2.03
  
• d1fcua_ appears in SCOPe 2.05
  
• d1fcua_ appears in the current release, SCOPe 2.08