Lineage for d1fawc_ (1faw C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1716076Protein Hemoglobin, alpha-chain [46486] (23 species)
  7. 1716169Species Graylag goose (Anser anser) [TaxId:8843] [68938] (1 PDB entry)
  8. 1716171Domain d1fawc_: 1faw C: [65004]
    Other proteins in same PDB: d1fawb_, d1fawd_
    complexed with hem, oxy

Details for d1fawc_

PDB Entry: 1faw (more details), 3.09 Å

PDB Description: graylag goose hemoglobin (oxy form)
PDB Compounds: (C:) hemoglobin (alpha subunit)

SCOPe Domain Sequences for d1fawc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fawc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Graylag goose (Anser anser) [TaxId: 8843]}
vlsaadktnvkgvfskigghaeeygaetlermftaypqtktyfphfdlqhgsaqikahgk
kvaaalveavnhiddiagalsklsdlhaqklrvdpvnfkflghcflvvvaihhpsaltpe
vhasldkflcavgtvltakyr

SCOPe Domain Coordinates for d1fawc_:

Click to download the PDB-style file with coordinates for d1fawc_.
(The format of our PDB-style files is described here.)

Timeline for d1fawc_: