Lineage for d1fawc_ (1faw C:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 93449Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 93450Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 93460Family a.1.1.2: Globins [46463] (18 proteins)
  6. 93559Protein Hemoglobin, alpha-chain [46486] (16 species)
  7. 93593Species Graylag goose (Anser anser) [TaxId:8843] [68938] (1 PDB entry)
  8. 93595Domain d1fawc_: 1faw C: [65004]
    Other proteins in same PDB: d1fawb_, d1fawd_

Details for d1fawc_

PDB Entry: 1faw (more details), 3.09 Å

PDB Description: graylag goose hemoglobin (oxy form)

SCOP Domain Sequences for d1fawc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fawc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Graylag goose (Anser anser)}
vlsaadktnvkgvfskigghaeeygaetlermftaypqtktyfphfdlqhgsaqikahgk
kvaaalveavnhiddiagalsklsdlhaqklrvdpvnfkflghcflvvvaihhpsaltpe
vhasldkflcavgtvltakyr

SCOP Domain Coordinates for d1fawc_:

Click to download the PDB-style file with coordinates for d1fawc_.
(The format of our PDB-style files is described here.)

Timeline for d1fawc_: