Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (2 families) forms trimers with three closely packed beta-sheets |
Family d.74.2.1: C-terminal domain of arginine repressor [55253] (1 protein) automatically mapped to Pfam PF02863 |
Protein C-terminal domain of arginine repressor [55254] (3 species) |
Species Bacillus subtilis [TaxId:1423] [69759] (2 PDB entries) |
Domain d1f9nd2: 1f9n D:79-149 [64997] Other proteins in same PDB: d1f9na1, d1f9nb1, d1f9nc1, d1f9nd1, d1f9ne1, d1f9nf1 |
PDB Entry: 1f9n (more details), 2.7 Å
SCOPe Domain Sequences for d1f9nd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f9nd2 d.74.2.1 (D:79-149) C-terminal domain of arginine repressor {Bacillus subtilis [TaxId: 1423]} almdafvkidsashmivlktmpgnaqaigalmdnldwdemmgticgddtiliicrtpedt egvknrllell
Timeline for d1f9nd2: