Lineage for d1f9nc2 (1f9n C:79-149)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958012Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958075Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (2 families) (S)
    forms trimers with three closely packed beta-sheets
  5. 2958076Family d.74.2.1: C-terminal domain of arginine repressor [55253] (1 protein)
    automatically mapped to Pfam PF02863
  6. 2958077Protein C-terminal domain of arginine repressor [55254] (3 species)
  7. 2958088Species Bacillus subtilis [TaxId:1423] [69759] (2 PDB entries)
  8. 2958094Domain d1f9nc2: 1f9n C:79-149 [64995]
    Other proteins in same PDB: d1f9na1, d1f9nb1, d1f9nc1, d1f9nd1, d1f9ne1, d1f9nf1

Details for d1f9nc2

PDB Entry: 1f9n (more details), 2.7 Å

PDB Description: crystal structure of ahrc, the arginine repressor/activator protein from bacillus subtilis
PDB Compounds: (C:) arginine repressor/activator protein

SCOPe Domain Sequences for d1f9nc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f9nc2 d.74.2.1 (C:79-149) C-terminal domain of arginine repressor {Bacillus subtilis [TaxId: 1423]}
almdafvkidsashmivlktmpgnaqaigalmdnldwdemmgticgddtiliicrtpedt
egvknrllell

SCOPe Domain Coordinates for d1f9nc2:

Click to download the PDB-style file with coordinates for d1f9nc2.
(The format of our PDB-style files is described here.)

Timeline for d1f9nc2: