Lineage for d1f3xb1 (1f3x B:116-217)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1132798Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 1132799Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 1132800Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
    this domain interrupts beta/alpha-barrel domain
    C-terminal domain is alpha/beta
  6. 1132801Protein Pyruvate kinase (PK) [50802] (6 species)
  7. 1132839Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [50803] (7 PDB entries)
  8. 1132873Domain d1f3xb1: 1f3x B:116-217 [64961]
    Other proteins in same PDB: d1f3xa2, d1f3xa3, d1f3xb2, d1f3xb3, d1f3xc2, d1f3xc3, d1f3xd2, d1f3xd3, d1f3xe2, d1f3xe3, d1f3xf2, d1f3xf3, d1f3xg2, d1f3xg3, d1f3xh2, d1f3xh3
    complexed with k, mn, pyr; mutant

Details for d1f3xb1

PDB Entry: 1f3x (more details), 2.8 Å

PDB Description: s402p mutant of rabbit muscle pyruvate kinase
PDB Compounds: (B:) pyruvate kinase

SCOPe Domain Sequences for d1f3xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3xb1 b.58.1.1 (B:116-217) Pyruvate kinase (PK) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
peirtglikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyv
ddglislqvkqkgpdflvtevenggflgskkgvnlpgaavdl

SCOPe Domain Coordinates for d1f3xb1:

Click to download the PDB-style file with coordinates for d1f3xb1.
(The format of our PDB-style files is described here.)

Timeline for d1f3xb1: