Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
Protein Hyaluronate lyase precatalytic domain [69167] (1 species) precedes the catalytic incomplete alpha5/alpha5 barrel a rudiment form of Ig-like domain |
Species Streptococcus agalactiae [TaxId:1311] [69168] (3 PDB entries) |
Domain d1f1sa2: 1f1s A:171-248 [64929] Other proteins in same PDB: d1f1sa1, d1f1sa3, d1f1sa4 |
PDB Entry: 1f1s (more details), 2.1 Å
SCOPe Domain Sequences for d1f1sa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f1sa2 b.1.18.2 (A:171-248) Hyaluronate lyase precatalytic domain {Streptococcus agalactiae [TaxId: 1311]} sehpqpvttqieksvntalnknyvfnkadyqytltnpslgkivggilypnatgsttvkis dksgkiikevplsvtast
Timeline for d1f1sa2: