Lineage for d1f1sa1 (1f1s A:249-619)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2007005Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2007336Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
    incomplete toroid
  5. 2007354Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (5 proteins)
  6. 2007372Protein Hyaluronate lyase [48237] (2 species)
  7. 2007393Species Streptococcus agalactiae [TaxId:1311] [69089] (3 PDB entries)
    preceded by a small all-beta Ig-like domain
  8. 2007394Domain d1f1sa1: 1f1s A:249-619 [64928]
    Other proteins in same PDB: d1f1sa2, d1f1sa3, d1f1sa4

Details for d1f1sa1

PDB Entry: 1f1s (more details), 2.1 Å

PDB Description: crystal structure of streptococcus agalactiae hyaluronate lyase at 2.1 angstrom resolution.
PDB Compounds: (A:) hyaluronate lyase

SCOPe Domain Sequences for d1f1sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1sa1 a.102.3.2 (A:249-619) Hyaluronate lyase {Streptococcus agalactiae [TaxId: 1311]}
ednftklldkwndvtignyvydtndsnmqklnqkldetnaknieaikldsnrtflwkdld
nlnnsaqltatyrrledlakqitnphstiyknekairtvkeslawlhqnfynvnkdiegs
anwwdfeigvprsitgtlslmnnyftdaeiktytdpiehfvpdaeyfrktlvnpfkalgg
nlvdmgrvkiiegllrkdntiiektshslknlfttatkaegfyadgsyidhtnvaytgay
gnvlidgltqllpiiqetdykisnqeldmvykwinqsflplivkgelmdmsrgrsisrea
asshaaavevlrgflrlanmsneernldlkstiktiitsnkfynvfnnlksysdianmnk
llndstvatkp

SCOPe Domain Coordinates for d1f1sa1:

Click to download the PDB-style file with coordinates for d1f1sa1.
(The format of our PDB-style files is described here.)

Timeline for d1f1sa1: