SCOP 1.69: Domain d1ez4d1: 1ez4 D:16-162

Lineage for d1ez4d1 (1ez4 D:16-162)

Root: SCOP 1.69
Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)
Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)
Protein Lactate dehydrogenase [51859] (13 species)
Species Lactobacillus pentosus [TaxId:1589] [69418] (1 PDB entry)
Domain d1ez4d1: 1ez4 D:16-162 [64923]
Other proteins in same PDB: d1ez4a2, d1ez4b2, d1ez4c2, d1ez4d2

Details for d1ez4d1

PDB Entry: 1ez4 (more details), 2.3 Å

PDB Description: crystal structure of non-allosteric l-lactate dehydrogenase from lactobacillus pentosus at 2.3 angstrom resolution

SCOP Domain Sequences for d1ez4d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ez4d1 c.2.1.5 (D:16-162) Lactate dehydrogenase {Lactobacillus pentosus}
smpnhqkvvlvgdgavgssyafamaqqgiaeefvivdvvkdrtkgdaldledaqaftapk
kiysgeysdckdadlvvitagapqkpgesrldlvnknlnilssivkpvvdsgfdgiflva
anpvdiltyatwkfsgfpkervigsg

SCOP Domain Coordinates for d1ez4d1:

Click to download the PDB-style file with coordinates for d1ez4d1.
(The format of our PDB-style files is described here.)

Timeline for d1ez4d1: