SCOPe 2.06: Domain d1ep7b_: 1ep7 B:

Lineage for d1ep7b_ (1ep7 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (16 species)

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [52838] (4 PDB entries)

8. Domain d1ep7b_: 1ep7 B: [64906]

Details for d1ep7b_

PDB Entry: 1ep7, 2.1 Å

PDB Description: crystal structure of wt thioredoxin h from chlamydomonas reinhardtii

PDB Compounds: (B:) thioredoxin ch1, h-type

SCOPe Domain Sequences for d1ep7b_:

Sequence; same for both SEQRES and ATOM records:

>d1ep7b_ c.47.1.1 (B:) Thioredoxin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
ggsvividskaawdaqlakgkeehkpivvdftatwcgpckmiaplfetlsndyagkvifl
kvdvdavaavaeaagitamptfhvykdgvkaddlvgasqdklkalvakhaaa

Timeline for d1ep7b_:

• d1ep7b_ first appeared in SCOP 1.59
  
• d1ep7b_ appears in SCOPe 2.05
  
• d1ep7b_ appears in the current release, SCOPe 2.07