Lineage for d1ep7a_ (1ep7 A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 123181Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 123182Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 123183Family c.47.1.1: Thioltransferase [52834] (6 proteins)
  6. 123213Protein Thioredoxin [52835] (7 species)
  7. 123218Species Chlamydomonas reinhardtii [TaxId:3055] [52838] (4 PDB entries)
  8. 123219Domain d1ep7a_: 1ep7 A: [64905]

Details for d1ep7a_

PDB Entry: 1ep7 (more details), 2.1 Å

PDB Description: crystal structure of wt thioredoxin h from chlamydomonas reinhardtii

SCOP Domain Sequences for d1ep7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii}
ggsvividskaawdaqlakgkeehkpivvdftatwcgpckmiaplfetlsndyagkvifl
kvdvdavaavaeaagitamptfhvykdgvkaddlvgasqdklkalvakhaaa

SCOP Domain Coordinates for d1ep7a_:

Click to download the PDB-style file with coordinates for d1ep7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ep7a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ep7b_