Lineage for d1ea6b2 (1ea6 B:27-231)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212981Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2212982Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2213403Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (7 proteins)
  6. 2213422Protein DNA mismatch repair protein PMS2 [69800] (1 species)
  7. 2213423Species Human (Homo sapiens) [TaxId:9606] [69801] (3 PDB entries)
  8. 2213427Domain d1ea6b2: 1ea6 B:27-231 [64874]
    Other proteins in same PDB: d1ea6a1, d1ea6b1
    protein/DNA complex; complexed with adp, mg

Details for d1ea6b2

PDB Entry: 1ea6 (more details), 2.7 Å

PDB Description: n-terminal 40kda fragment of nhpms2 complexed with adp
PDB Compounds: (B:) pms1 protein homolog 2

SCOPe Domain Sequences for d1ea6b2:

Sequence, based on SEQRES records: (download)

>d1ea6b2 d.122.1.2 (B:27-231) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]}
csgqvvlslstavkelvensldagatnidlklkdygvdlievsdngcgveeenfegltlk
hhtskiqefadltqvetfgfrgealsslcalsdvtistchasakvgtrlmfdhngkiiqk
tpyprprgttvsvqqlfstlpvrhkefqrnikkeyakmvqvlhayciisagirvsctnql
gqgkrqpvvctggspsikenigsvf

Sequence, based on observed residues (ATOM records): (download)

>d1ea6b2 d.122.1.2 (B:27-231) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]}
csgqvvlslstavkelvensldagatnidlklkdygvdlievsdngcgveeenfegltle
alsslcalsdvtistchasakvgtrlmfdhngkiiqktpyprprgttvsvqqlfstlpvr
hkefqrnikkeyakmvqvlhayciisagirvsctnqlgqgkrqpvvctggspsikenigs
vf

SCOPe Domain Coordinates for d1ea6b2:

Click to download the PDB-style file with coordinates for d1ea6b2.
(The format of our PDB-style files is described here.)

Timeline for d1ea6b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ea6b1