Lineage for d1e9sb_ (1e9s B:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242911Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 242912Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) (S)
    division into families based on beta-sheet topologies
  5. 243788Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (9 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 243803Protein Bacterial conjugative coupling protein TrwB [69492] (1 species)
  7. 243804Species Escherichia coli [TaxId:562] [69493] (5 PDB entries)
  8. 243812Domain d1e9sb_: 1e9s B: [64834]

Details for d1e9sb_

PDB Entry: 1e9s (more details), 2.5 Å

PDB Description: bacterial conjugative coupling protein trwbdeltan70. unbound monoclinic form.
PDB Compounds: (B:)

SCOP Domain Sequences for d1e9sb_:

Sequence, based on SEQRES records: (download)

>d1e9sb_ c.37.1.11 (B:) Bacterial conjugative coupling protein TrwB {Escherichia coli}
nsvgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvnga
tgtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffnei
rndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatf
ddlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpngg
nlfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladal
tkgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslg
eheverdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvple
ikqfanrqpafve

Sequence, based on observed residues (ATOM records): (download)

>d1e9sb_ c.37.1.11 (B:) Bacterial conjugative coupling protein TrwB {Escherichia coli}
nsvgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvnga
tgtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffnei
rndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatf
ddlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpngg
nlfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladal
tkgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslg
eheverdryralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpaf
ve

SCOP Domain Coordinates for d1e9sb_:

Click to download the PDB-style file with coordinates for d1e9sb_.
(The format of our PDB-style files is described here.)

Timeline for d1e9sb_: