Lineage for d1e9ic2 (1e9i C:1-139)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328547Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 328548Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 328549Family d.54.1.1: Enolase N-terminal domain-like [54827] (8 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 328592Protein Enolase [54828] (5 species)
  7. 328616Species Escherichia coli [TaxId:562] [69710] (1 PDB entry)
  8. 328619Domain d1e9ic2: 1e9i C:1-139 [64823]
    Other proteins in same PDB: d1e9ia1, d1e9ib1, d1e9ic1, d1e9id1

Details for d1e9ic2

PDB Entry: 1e9i (more details), 2.48 Å

PDB Description: enolase from e.coli
PDB Compounds: (C:)

SCOP Domain Sequences for d1e9ic2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e9ic2 d.54.1.1 (C:1-139) Enolase {Escherichia coli}
skivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrflg
kgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanaka
aaaakgmplyehiaelngt

SCOP Domain Coordinates for d1e9ic2:

Click to download the PDB-style file with coordinates for d1e9ic2.
(The format of our PDB-style files is described here.)

Timeline for d1e9ic2: