Lineage for d1db9a2 (1db9 A:8-137)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 115107Fold b.82: Double-stranded beta-helix [51181] (6 superfamilies)
  4. 115221Superfamily b.82.3: cAMP-binding domain-like [51206] (2 families) (S)
  5. 115227Family b.82.3.2: cAMP-binding domain [51210] (2 proteins)
  6. 115228Protein Catabolite gene activator protein, N-terminal domain [51211] (1 species)
  7. 115229Species Escherichia coli [TaxId:562] [51212] (11 PDB entries)
  8. 115247Domain d1db9a2: 1db9 A:8-137 [64783]
    Other proteins in same PDB: d1db9a1

Details for d1db9a2

PDB Entry: 1db9 (more details), 3 Å

PDB Description: protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes

SCOP Domain Sequences for d1db9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1db9a2 b.82.3.2 (A:8-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli}
dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqg
dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvt
sekvgnlafl

SCOP Domain Coordinates for d1db9a2:

Click to download the PDB-style file with coordinates for d1db9a2.
(The format of our PDB-style files is described here.)

Timeline for d1db9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1db9a1