Lineage for d1db9a1 (1db9 A:138-207)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94900Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 95173Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (32 families) (S)
  5. 95206Family a.4.5.4: CAP C-terminal domain-like [46796] (2 proteins)
  6. 95207Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
  7. 95208Species Escherichia coli [TaxId:562] [46798] (11 PDB entries)
  8. 95226Domain d1db9a1: 1db9 A:138-207 [64782]
    Other proteins in same PDB: d1db9a2

Details for d1db9a1

PDB Entry: 1db9 (more details), 3 Å

PDB Description: protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes

SCOP Domain Sequences for d1db9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1db9a1 a.4.5.4 (A:138-207) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsrdtvgrilkmledqnlis
ahgktivvyg

SCOP Domain Coordinates for d1db9a1:

Click to download the PDB-style file with coordinates for d1db9a1.
(The format of our PDB-style files is described here.)

Timeline for d1db9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1db9a2