Lineage for d1ci8b_ (1ci8 B:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2244157Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2244863Protein Esterase EstB [69873] (1 species)
  7. 2244864Species Burkholderia gladioli [TaxId:28095] [69874] (2 PDB entries)
  8. 2244868Domain d1ci8b_: 1ci8 B: [64766]
    complexed with ipa

Details for d1ci8b_

PDB Entry: 1ci8 (more details), 2 Å

PDB Description: esterase estb from burkholderia gladioli: an esterase with (beta)- lactamase fold.
PDB Compounds: (B:) protein (carboxylesterase)

SCOPe Domain Sequences for d1ci8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ci8b_ e.3.1.1 (B:) Esterase EstB {Burkholderia gladioli [TaxId: 28095]}
aaslaarldavfdqalrerrlvgavaivarhgeilyrraqgladreagrpmredtlfrla
svtkpivalavlrlvargelaldapvtrwlpefrprladgseplvtihhllthtsglgyw
llegagsvydrlgisdgidlrdfdldenlrrlasaplsfapgsgwqyslaldvlgavver
atgqplaaavdalvaqplgmrdcgfvsaeperfavpyhdgqpepvrmrdgievplpeghg
aavrfapsrvfepgaypsggagmygsaddvlraleairanpgflpetladaarrdqagvg
aetrgpgwgfgylsavlddpaaagtpqhagtlqwggvyghswfvdralglsvllltntay
egmsgpltialrdavya

SCOPe Domain Coordinates for d1ci8b_:

Click to download the PDB-style file with coordinates for d1ci8b_.
(The format of our PDB-style files is described here.)

Timeline for d1ci8b_: