Lineage for d1bqea2 (1bqe A:142-303)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 120976Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
  4. 120977Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
  5. 120978Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 120985Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)
  7. 120988Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [52350] (12 PDB entries)
  8. 120997Domain d1bqea2: 1bqe A:142-303 [64761]
    Other proteins in same PDB: d1bqea1

Details for d1bqea2

PDB Entry: 1bqe (more details), 2.45 Å

PDB Description: ferredoxin:nadp+ reductase mutant with thr 155 replaced by gly (t155g)

SCOP Domain Sequences for d1bqea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqea2 c.25.1.1 (A:142-303) Ferredoxin reductase (flavodoxin reductase) {Cyanobacterium (Anabaena sp.), pcc 7119}
lpddpeanvimlaggtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily
keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlwqliknqkthtyic
glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety

SCOP Domain Coordinates for d1bqea2:

Click to download the PDB-style file with coordinates for d1bqea2.
(The format of our PDB-style files is described here.)

Timeline for d1bqea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bqea1