SCOP 1.73: Domain d6paxa2: 6pax A:69-133

Lineage for d6paxa2 (6pax A:69-133)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (17 families)
   consists only of helices

5. Family a.4.1.5: Paired domain [46748] (3 proteins)
   duplication: consists of two domains of this fold

6. Protein Pax-6 [68936] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46750] (1 PDB entry)

8. Domain d6paxa2: 6pax A:69-133 [64759]

Details for d6paxa2

PDB Entry: 6pax, 2.5 Å

PDB Description: crystal structure of the human pax-6 paired domain-dna complex reveals a general model for pax protein-dna interactions

PDB Compounds: (A:) homeobox protein pax-6

SCOP Domain Sequences for d6paxa2:

Sequence; same for both SEQRES and ATOM records:

>d6paxa2 a.4.1.5 (A:69-133) Pax-6 {Human (Homo sapiens) [TaxId: 9606]}
ggskprvatpevvskiaqykqecpsifaweirdrllsegvctndnipsvssinrvlrnla
sekqq

Timeline for d6paxa2:

• d6paxa2 first appeared in SCOP 1.59
  
• d6paxa2 appears in SCOP 1.71
  
• d6paxa2 appears in SCOP 1.75
  
• d6paxa2 appears in the current release, SCOPe 2.08