Lineage for d6paxa2 (6pax A:69-133)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 438100Superfamily a.4.1: Homeodomain-like [46689] (13 families) (S)
    consists only of helices
  5. 438309Family a.4.1.5: Paired domain [46748] (3 proteins)
    duplication: consists of two domains of this fold
  6. 438322Protein Pax-6 [68936] (1 species)
  7. 438323Species Human (Homo sapiens) [TaxId:9606] [46750] (1 PDB entry)
  8. 438325Domain d6paxa2: 6pax A:69-133 [64759]

Details for d6paxa2

PDB Entry: 6pax (more details), 2.5 Å

PDB Description: crystal structure of the human pax-6 paired domain-dna complex reveals a general model for pax protein-dna interactions

SCOP Domain Sequences for d6paxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6paxa2 a.4.1.5 (A:69-133) Pax-6 {Human (Homo sapiens)}
ggskprvatpevvskiaqykqecpsifaweirdrllsegvctndnipsvssinrvlrnla
sekqq

SCOP Domain Coordinates for d6paxa2:

Click to download the PDB-style file with coordinates for d6paxa2.
(The format of our PDB-style files is described here.)

Timeline for d6paxa2:

438325
d6paxa2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d6paxa1