Lineage for d6paxa1 (6pax A:1-68)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 532781Superfamily a.4.1: Homeodomain-like [46689] (13 families) (S)
    consists only of helices
  5. 533014Family a.4.1.5: Paired domain [46748] (3 proteins)
    duplication: consists of two domains of this fold
  6. 533027Protein Pax-6 [68936] (1 species)
  7. 533028Species Human (Homo sapiens) [TaxId:9606] [46750] (1 PDB entry)
  8. 533029Domain d6paxa1: 6pax A:1-68 [64758]

Details for d6paxa1

PDB Entry: 6pax (more details), 2.5 Å

PDB Description: crystal structure of the human pax-6 paired domain-dna complex reveals a general model for pax protein-dna interactions

SCOP Domain Sequences for d6paxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6paxa1 a.4.1.5 (A:1-68) Pax-6 {Human (Homo sapiens)}
shsgvnqlggvfvngrplpdstrqrivelahsgarpcdisrilqvsngcvskilgryyat
gsirprai

SCOP Domain Coordinates for d6paxa1:

Click to download the PDB-style file with coordinates for d6paxa1.
(The format of our PDB-style files is described here.)

Timeline for d6paxa1:

533029
d6paxa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d6paxa2