SCOPe 2.08: Domain d6paxa1: 6pax A:1-68

Lineage for d6paxa1 (6pax A:1-68)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.5: Paired domain [46748] (3 proteins)
   duplication: consists of two domains of this fold

6. Protein Pax-6 [68936] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46750] (1 PDB entry)

8. Domain d6paxa1: 6pax A:1-68 [64758]
   protein/DNA complex

Details for d6paxa1

PDB Entry: 6pax, 2.5 Å

PDB Description: crystal structure of the human pax-6 paired domain-dna complex reveals a general model for pax protein-dna interactions

PDB Compounds: (A:) homeobox protein pax-6

SCOPe Domain Sequences for d6paxa1:

Sequence; same for both SEQRES and ATOM records:

>d6paxa1 a.4.1.5 (A:1-68) Pax-6 {Human (Homo sapiens) [TaxId: 9606]}
shsgvnqlggvfvngrplpdstrqrivelahsgarpcdisrilqvsngcvskilgryyat
gsirprai

Timeline for d6paxa1:

• d6paxa1 first appeared in SCOP 1.59
  
• d6paxa1 appears in SCOPe 2.07