Lineage for d1jeqa1 (1jeq A:559-609)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 101768Fold a.140: LEM/SAP HeH motif [63450] (4 superfamilies)
  4. 101778Superfamily a.140.2: SAP domain [68906] (1 family) (S)
  5. 101779Family a.140.2.1: SAP domain [68907] (2 proteins)
  6. 101780Protein DNA binding C-terminal domain of ku70 [68908] (1 species)
  7. 101781Species Human (Homo sapiens) [TaxId:9606] [68909] (2 PDB entries)
  8. 101782Domain d1jeqa1: 1jeq A:559-609 [64748]
    Other proteins in same PDB: d1jeqa2, d1jeqb_

Details for d1jeqa1

PDB Entry: 1jeq (more details), 2.7 Å

PDB Description: crystal structure of the ku heterodimer

SCOP Domain Sequences for d1jeqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jeqa1 a.140.2.1 (A:559-609) DNA binding C-terminal domain of ku70 {Human (Homo sapiens)}
yseeelkthiskgtlgkftvpmlkeacrayglksglkkqellealtkhfqd

SCOP Domain Coordinates for d1jeqa1:

Click to download the PDB-style file with coordinates for d1jeqa1.
(The format of our PDB-style files is described here.)

Timeline for d1jeqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jeqa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1jeqb_