Lineage for d1fcfa4 (1fcf A:77-156,A:249-463)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 177168Fold c.14: ClpP/crotonase [52095] (1 superfamily)
  4. 177169Superfamily c.14.1: ClpP/crotonase [52096] (3 families) (S)
  5. 177187Family c.14.1.2: Tail specific protease, catalytic domain [52100] (3 proteins)
  6. 177191Protein Photosystem II D1 C-terminal processing protease [68935] (1 species)
  7. 177192Species Algae (Scenedesmus obliquus) [TaxId:3088] [52102] (4 PDB entries)
  8. 177196Domain d1fcfa4: 1fcf A:77-156,A:249-463 [64745]
    Other proteins in same PDB: d1fcfa3

Details for d1fcfa4

PDB Entry: 1fcf (more details), 2.1 Å

PDB Description: photosystem ii d1 c-terminal processing protease

SCOP Domain Sequences for d1fcfa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fcfa4 c.14.1.2 (A:77-156,A:249-463) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus)}
mvtseqllfleawravdrayvdksfngqswfklretylkkepmdrraqtydairkllavl
ddpftrflepsrlaalrrgtXkvtinpvtfttcsnvaaaalppgaakqqlgyvrlatfns
nttaaaqqaftelskqgvaglvldirnnggglfpagvnvarmlvdrgdlvliadsqgird
iysadgnsidsatplvvlvnrgtasasevlagalkdskrgliagertfgkgliqtvvdls
dgsgvavtvaryqtpagvdinkigvspdvqldpevlptdlegvcrvlgsdaaprlf

SCOP Domain Coordinates for d1fcfa4:

Click to download the PDB-style file with coordinates for d1fcfa4.
(The format of our PDB-style files is described here.)

Timeline for d1fcfa4:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fcfa3