Lineage for d1fc9a4 (1fc9 A:78-156,A:249-463)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119892Fold c.14: ClpP/crotonase [52095] (1 superfamily)
  4. 119893Superfamily c.14.1: ClpP/crotonase [52096] (3 families) (S)
  5. 119911Family c.14.1.2: Tail specific protease, catalytic domain [52100] (3 proteins)
  6. 119915Protein Photosystem II D1 C-terminal processing protease [68935] (1 species)
  7. 119916Species Algae (Scenedesmus obliquus) [TaxId:3088] [52102] (4 PDB entries)
  8. 119918Domain d1fc9a4: 1fc9 A:78-156,A:249-463 [64743]
    Other proteins in same PDB: d1fc9a3

Details for d1fc9a4

PDB Entry: 1fc9 (more details), 1.9 Å

PDB Description: photosystem ii d1 c-terminal processing protease

SCOP Domain Sequences for d1fc9a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fc9a4 c.14.1.2 (A:78-156,A:249-463) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus)}
vtseqllfleawravdrayvdksfngqswfklretylkkepmdrraqtydairkllavld
dpftrflepsrlaalrrgtXkvtinpvtfttcsnvaaaalppgaakqqlgyvrlatfnsn
ttaaaqqaftelskqgvaglvldirnnggglfpagvnvarmlvdrgdlvliadsqgirdi
ysadgnsidsatplvvlvnrgtasasevlagalkdskrgliagertfgkgliqtvvdlsd
gsgvavtvaryqtpagvdinkigvspdvqldpevlptdlegvcrvlgsdaaprlf

SCOP Domain Coordinates for d1fc9a4:

Click to download the PDB-style file with coordinates for d1fc9a4.
(The format of our PDB-style files is described here.)

Timeline for d1fc9a4:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fc9a3