Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.2: Tail specific protease, catalytic domain [52100] (3 proteins) includes N-terminal all-alpha subdomain |
Protein Photosystem II D1 C-terminal processing protease [68935] (1 species) |
Species Algae (Scenedesmus obliquus) [TaxId:3088] [52102] (4 PDB entries) |
Domain d1fc9a4: 1fc9 A:78-156,A:249-463 [64743] Other proteins in same PDB: d1fc9a3 |
PDB Entry: 1fc9 (more details), 1.9 Å
SCOPe Domain Sequences for d1fc9a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fc9a4 c.14.1.2 (A:78-156,A:249-463) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} vtseqllfleawravdrayvdksfngqswfklretylkkepmdrraqtydairkllavld dpftrflepsrlaalrrgtXkvtinpvtfttcsnvaaaalppgaakqqlgyvrlatfnsn ttaaaqqaftelskqgvaglvldirnnggglfpagvnvarmlvdrgdlvliadsqgirdi ysadgnsidsatplvvlvnrgtasasevlagalkdskrgliagertfgkgliqtvvdlsd gsgvavtvaryqtpagvdinkigvspdvqldpevlptdlegvcrvlgsdaaprlf
Timeline for d1fc9a4: