Lineage for d1fc6a3 (1fc6 A:157-248)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109876Fold b.36: PDZ domain-like [50155] (1 superfamily)
  4. 109877Superfamily b.36.1: PDZ domain-like [50156] (3 families) (S)
  5. 109915Family b.36.1.3: Tail specific protease PDZ domain [68933] (2 proteins)
  6. 109916Protein Photosystem II D1 C-terminal processing protease [68934] (1 species)
  7. 109917Species Algae (Scenedesmus obliquus) [TaxId:3088] [50171] (4 PDB entries)
  8. 109918Domain d1fc6a3: 1fc6 A:157-248 [64738]
    Other proteins in same PDB: d1fc6a4

Details for d1fc6a3

PDB Entry: 1fc6 (more details), 1.8 Å

PDB Description: photosystem ii d1 c-terminal processing protease

SCOP Domain Sequences for d1fc6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus)}
agsvtgvgleitydggsgkdvvvltpapggpaekagaragdvivtvdgtavkgmslydvs
dllqgeadsqvevvlhapgapsntrtlqltrq

SCOP Domain Coordinates for d1fc6a3:

Click to download the PDB-style file with coordinates for d1fc6a3.
(The format of our PDB-style files is described here.)

Timeline for d1fc6a3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fc6a4