Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures |
Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) common motif contains conserved histidine residue and metal-binding site |
Family d.4.1.5: Recombination endonuclease VII, N-terminal domain [68915] (1 protein) |
Protein Recombination endonuclease VII, N-terminal domain [68916] (1 species) |
Species Bacteriophage T4 [TaxId:10665] [68917] (5 PDB entries) |
Domain d1en7b2: 1en7 B:1-103 [64736] Other proteins in same PDB: d1en7a1, d1en7b1 complexed with ca, zn |
PDB Entry: 1en7 (more details), 2.4 Å
SCOPe Domain Sequences for d1en7b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1en7b2 d.4.1.5 (B:1-103) Recombination endonuclease VII, N-terminal domain {Bacteriophage T4 [TaxId: 10665]} mlltgklykeekqkfydaqngkclicqrelnpdvqanhldhdhelngpkagkvrgllcnl cnaaegqmkhkfnrsglkgqgvdylewlenlltylksdytqnn
Timeline for d1en7b2: