Lineage for d1en7b2 (1en7 B:1-103)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2927847Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 2927848Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 2927955Family d.4.1.5: Recombination endonuclease VII, N-terminal domain [68915] (1 protein)
  6. 2927956Protein Recombination endonuclease VII, N-terminal domain [68916] (1 species)
  7. 2927957Species Bacteriophage T4 [TaxId:10665] [68917] (5 PDB entries)
  8. 2927961Domain d1en7b2: 1en7 B:1-103 [64736]
    Other proteins in same PDB: d1en7a1, d1en7b1
    complexed with ca, zn

Details for d1en7b2

PDB Entry: 1en7 (more details), 2.4 Å

PDB Description: endonuclease vii (endovii) from phage t4
PDB Compounds: (B:) recombination endonuclease vii

SCOPe Domain Sequences for d1en7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1en7b2 d.4.1.5 (B:1-103) Recombination endonuclease VII, N-terminal domain {Bacteriophage T4 [TaxId: 10665]}
mlltgklykeekqkfydaqngkclicqrelnpdvqanhldhdhelngpkagkvrgllcnl
cnaaegqmkhkfnrsglkgqgvdylewlenlltylksdytqnn

SCOPe Domain Coordinates for d1en7b2:

Click to download the PDB-style file with coordinates for d1en7b2.
(The format of our PDB-style files is described here.)

Timeline for d1en7b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1en7b1