Lineage for d1efm_1 (1efm 12-190)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 121912Family c.37.1.8: G proteins [52592] (23 proteins)
  6. 122012Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 122018Species Escherichia coli [TaxId:562] [52627] (6 PDB entries)
  8. 122028Domain d1efm_1: 1efm 12-190 [64732]

Details for d1efm_1

PDB Entry: 1efm (more details), 2.7 Å

PDB Description: structure of the gdp domain of ef-tu and location of the amino acids homologous to ras oncogene proteins

SCOP Domain Sequences for d1efm_1:

Sequence, based on SEQRES records: (download)

>d1efm_1 c.37.1.8 (12-190) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli}
vnvgtighvdhgkttltaaittvlaktyggaarxxxxxxxxxxxxxxgitintshveydt
ptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyii
vflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweakile

Sequence, based on observed residues (ATOM records): (download)

>d1efm_1 c.37.1.8 (12-190) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli}
vnvgtighvdhgkttltaaittvlaktytintshveydtptrhyahvdcpghadyvknmi
tgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvddeellelveme
vrellsqydfpgddtpivrgsalkalegdaeweakile

SCOP Domain Coordinates for d1efm_1:

Click to download the PDB-style file with coordinates for d1efm_1.
(The format of our PDB-style files is described here.)

Timeline for d1efm_1: