Lineage for d1e7db1 (1e7d B:104-157)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 101768Fold a.140: LEM/SAP HeH motif [63450] (4 superfamilies)
  4. 101799Superfamily a.140.4: Recombination endonuclease VII, C-terminal and dimerization domains [68918] (1 family) (S)
  5. 101800Family a.140.4.1: Recombination endonuclease VII, C-terminal and dimerization domains [68919] (1 protein)
  6. 101801Protein Recombination endonuclease VII, C-terminal and dimerization domains [68920] (1 species)
  7. 101802Species Bacteriophage T4 [TaxId:10665] [54074] (3 PDB entries)
  8. 101808Domain d1e7db1: 1e7d B:104-157 [64726]
    Other proteins in same PDB: d1e7da2, d1e7db2

Details for d1e7db1

PDB Entry: 1e7d (more details), 2.8 Å

PDB Description: endonuclease vii (endovii) ffrom phage t4

SCOP Domain Sequences for d1e7db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7db1 a.140.4.1 (B:104-157) Recombination endonuclease VII, C-terminal and dimerization domains {Bacteriophage T4}
ihpnfvgdkskefsrlgkeemmaemlqrgfeynesdtktqliasfkkqlrkslk

SCOP Domain Coordinates for d1e7db1:

Click to download the PDB-style file with coordinates for d1e7db1.
(The format of our PDB-style files is described here.)

Timeline for d1e7db1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e7db2