Class a: All alpha proteins [46456] (151 folds) |
Fold a.140: LEM/SAP HeH motif [63450] (4 superfamilies) |
Superfamily a.140.4: Recombination endonuclease VII, C-terminal and dimerization domains [68918] (1 family) |
Family a.140.4.1: Recombination endonuclease VII, C-terminal and dimerization domains [68919] (1 protein) |
Protein Recombination endonuclease VII, C-terminal and dimerization domains [68920] (1 species) |
Species Bacteriophage T4 [TaxId:10665] [54074] (3 PDB entries) |
Domain d1e7db1: 1e7d B:104-157 [64726] Other proteins in same PDB: d1e7da2, d1e7db2 |
PDB Entry: 1e7d (more details), 2.8 Å
SCOP Domain Sequences for d1e7db1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e7db1 a.140.4.1 (B:104-157) Recombination endonuclease VII, C-terminal and dimerization domains {Bacteriophage T4} ihpnfvgdkskefsrlgkeemmaemlqrgfeynesdtktqliasfkkqlrkslk
Timeline for d1e7db1: