Lineage for d1dl5a1 (1dl5 A:1-213)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 125563Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
  4. 125564Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (18 families) (S)
  5. 125608Family c.66.1.7: Protein-L-isoaspartyl O-methyltransferase [53354] (1 protein)
  6. 125609Protein Protein-L-isoaspartyl O-methyltransferase [68927] (3 species)
  7. 125618Species Thermotoga maritima [TaxId:243274] [68928] (1 PDB entry)
  8. 125619Domain d1dl5a1: 1dl5 A:1-213 [64720]
    Other proteins in same PDB: d1dl5a2, d1dl5b2

Details for d1dl5a1

PDB Entry: 1dl5 (more details), 1.8 Å

PDB Description: protein-l-isoaspartate o-methyltransferase

SCOP Domain Sequences for d1dl5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima}
mreklfwilkkygvsdhiakafleipreefltksyplsyvyedivlvsyddgeeystssq
pslmalfmewvgldkgmrvleigggtgynaavmsrvvgekglvvsveysrkiceiakrnv
erlgienvifvcgdgyygvpefspydvifvtvgvdevpetwftqlkeggrvivpinlkls
rrqpaflfkkkdpylvgnykletrfitaggnlg

SCOP Domain Coordinates for d1dl5a1:

Click to download the PDB-style file with coordinates for d1dl5a1.
(The format of our PDB-style files is described here.)

Timeline for d1dl5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dl5a2