Lineage for d1ayl_2 (1ayl 1-227)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily) Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (1 family) 
Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (2 proteins) Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-liase) [68925] (2 species) Species Escherichia coli [TaxId:562] [68926] (5 PDB entries) 
Domain d1ayl_2: 1ayl 1-227 [64719]
Other proteins in same PDB: d1ayl_1
Details for d1ayl_2
PDB Entry: 1ayl (more details), 1.8 Å
PDB Description: phosphoenolpyruvate carboxykinase
SCOP Domain Sequences for d1ayl_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ayl_2 c.109.1.1 (1-227) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-liase) {Escherichia coli}
mrvnngltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtg
iftgrspkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfv
vdafcganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqw
keqglnsenfvafnltermqliggtwyggemkkgmfsmmnyllplkg
SCOP Domain Coordinates for d1ayl_2:
Click to download the PDB-style file with coordinates for d1ayl_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ayl_2:
- d1ayl_2 is new in SCOP 1.59
- d1ayl_2 appears in SCOP 1.61
- d1ayl_2 appears in the current release, SCOPe 2.08, called d1ayla2
View in 3D
