SCOPe 2.05: Domain d1aq2a2: 1aq2 A:4-227

Lineage for d1aq2a2 (1aq2 A:4-227)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
   contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain

4. Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families)

5. Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins)

6. Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68925] (4 species)

7. Species Escherichia coli [TaxId:562] [68926] (10 PDB entries)

8. Domain d1aq2a2: 1aq2 A:4-227 [64717]
   Other proteins in same PDB: d1aq2a1
   complexed with atp, mg, mn, pyr

Details for d1aq2a2

PDB Entry: 1aq2, 1.9 Å

PDB Description: phosphoenolpyruvate carboxykinase

PDB Compounds: (A:) phosphoenolpyruvate carboxykinase

SCOPe Domain Sequences for d1aq2a2:

Sequence; same for both SEQRES and ATOM records:

>d1aq2a2 c.109.1.1 (A:4-227) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]}
nngltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgift
grspkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvda
fcganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeq
glnsenfvafnltermqliggtwyggemkkgmfsmmnyllplkg

Timeline for d1aq2a2:

• d1aq2a2 first appeared in SCOP 1.59, called d1aq2_2
  
• d1aq2a2 appears in SCOPe 2.04
  
• d1aq2a2 appears in SCOPe 2.06
  
• d1aq2a2 appears in the current release, SCOPe 2.08