Lineage for d1aq2_2 (1aq2 4-227)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 128765Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
  4. 128766Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (1 family) (S)
  5. 128767Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (2 proteins)
  6. 128774Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-liase) [68925] (2 species)
  7. 128775Species Escherichia coli [TaxId:562] [68926] (5 PDB entries)
  8. 128779Domain d1aq2_2: 1aq2 4-227 [64717]
    Other proteins in same PDB: d1aq2_1

Details for d1aq2_2

PDB Entry: 1aq2 (more details), 1.9 Å

PDB Description: phosphoenolpyruvate carboxykinase

SCOP Domain Sequences for d1aq2_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aq2_2 c.109.1.1 (4-227) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-liase) {Escherichia coli}
nngltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgift
grspkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvda
fcganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeq
glnsenfvafnltermqliggtwyggemkkgmfsmmnyllplkg

SCOP Domain Coordinates for d1aq2_2:

Click to download the PDB-style file with coordinates for d1aq2_2.
(The format of our PDB-style files is described here.)

Timeline for d1aq2_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aq2_1