Lineage for d1aq2_1 (1aq2 228-540)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 127896Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
  4. 127897Superfamily c.91.1: PEP carboxykinase-like [53795] (2 families) (S)
  5. 127898Family c.91.1.1: PEP carboxykinase C-terminal domain [53796] (2 proteins)
  6. 127905Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-liase) [68921] (2 species)
  7. 127906Species Escherichia coli [TaxId:562] [53798] (5 PDB entries)
  8. 127910Domain d1aq2_1: 1aq2 228-540 [64716]
    Other proteins in same PDB: d1aq2_2

Details for d1aq2_1

PDB Entry: 1aq2 (more details), 1.9 Å

PDB Description: phosphoenolpyruvate carboxykinase

SCOP Domain Sequences for d1aq2_1:

Sequence, based on SEQRES records: (download)

>d1aq2_1 c.91.1.1 (228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-liase) {Escherichia coli}
iasmhcsanvgekgdvavffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcya
ktiklskeaepeiynairrdallenvtvredgtidfddgsktentrvsypiyhidnivkp
vskaghatkvifltadafgvlppvsrltadqtqyhflsgftaklagtergiteptptfsa
cfgaaflslhptqyaevlvkrmqaagaqaylvntgwngtgkrisikdtraiidailngsl
dnaetftlpmfnlaiptelpgvdtkildprntyaspeqwqekaetlaklfidnfdkytdt
pagaalvaagpkl

Sequence, based on observed residues (ATOM records): (download)

>d1aq2_1 c.91.1.1 (228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-liase) {Escherichia coli}
iasmhcsanvgekgdvavffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcya
ktiklskeaepeiynairrdallenvtvredgtidfddgsktentrvsypiyhidnivkp
vskaghatkvifltadafgvlppvsrltadqtqyhflsgftaklagtiteptptfsacfg
aaflslhptqyaevlvkrmqaagaqaylvntgwngtgkrisikdtraiidailngsldna
etftlpmfnlaiptelpgvdtkildprntyaspeqwqekaetlaklfidnfdkytdtpag
aalvaagpkl

SCOP Domain Coordinates for d1aq2_1:

Click to download the PDB-style file with coordinates for d1aq2_1.
(The format of our PDB-style files is described here.)

Timeline for d1aq2_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aq2_2