Lineage for d1a8vb2 (1a8v B:48-118)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 110053Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 110553Superfamily b.40.4: Nucleic acid-binding proteins [50249] (9 families) (S)
  5. 110688Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (13 proteins)
  6. 110730Protein Rho termination factor, RNA-binding domain [68910] (1 species)
  7. 110731Species Escherichia coli [TaxId:562] [68911] (4 PDB entries)
  8. 110734Domain d1a8vb2: 1a8v B:48-118 [64715]
    Other proteins in same PDB: d1a8va1, d1a8vb1

Details for d1a8vb2

PDB Entry: 1a8v (more details), 2 Å

PDB Description: structure of the rna-binding domain of the rho transcription terminator

SCOP Domain Sequences for d1a8vb2:

Sequence, based on SEQRES records: (download)

>d1a8vb2 b.40.4.5 (B:48-118) Rho termination factor, RNA-binding domain {Escherichia coli}
difgdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkeg
eryfallkvne

Sequence, based on observed residues (ATOM records): (download)

>d1a8vb2 b.40.4.5 (B:48-118) Rho termination factor, RNA-binding domain {Escherichia coli}
difgdgvleilqdgfgflrsadagpddiyvspsqirrfnlrtgdtisgkirppkegeryf
allkvne

SCOP Domain Coordinates for d1a8vb2:

Click to download the PDB-style file with coordinates for d1a8vb2.
(The format of our PDB-style files is described here.)

Timeline for d1a8vb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a8vb1