Lineage for d1a8vb1 (1a8v B:-1-47)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 101768Fold a.140: LEM/SAP HeH motif [63450] (4 superfamilies)
  4. 101788Superfamily a.140.3: Rho termination factor, N-terminal domain [68912] (1 family) (S)
  5. 101789Family a.140.3.1: Rho termination factor, N-terminal domain [68913] (1 protein)
  6. 101790Protein Rho termination factor, N-terminal domain [68914] (1 species)
  7. 101791Species Escherichia coli [TaxId:562] [50295] (4 PDB entries)
  8. 101794Domain d1a8vb1: 1a8v B:-1-47 [64714]
    Other proteins in same PDB: d1a8va2, d1a8vb2

Details for d1a8vb1

PDB Entry: 1a8v (more details), 2 Å

PDB Description: structure of the rna-binding domain of the rho transcription terminator

SCOP Domain Sequences for d1a8vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a8vb1 a.140.3.1 (B:-1-47) Rho termination factor, N-terminal domain {Escherichia coli}
ghmnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksge

SCOP Domain Coordinates for d1a8vb1:

Click to download the PDB-style file with coordinates for d1a8vb1.
(The format of our PDB-style files is described here.)

Timeline for d1a8vb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a8vb2