SCOPe 2.07: Domain d3tgke_: 3tgk E:

Lineage for d3tgke_ (3tgk E:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [50518] (37 PDB entries)

8. Domain d3tgke_: 3tgk E: [63338]
   Other proteins in same PDB: d3tgki_
   complexed with ca, so4; mutant

Details for d3tgke_

PDB Entry: 3tgk, 1.7 Å

PDB Description: trypsinogen mutant d194n and deletion of ile 16-val 17 complexed with bovine pancreatic trypsin inhibitor (bpti)

PDB Compounds: (E:) trypsin II, anionic

SCOPe Domain Sequences for d3tgke_:

Sequence, based on SEQRES records:

>d3tgke_ b.47.1.2 (E:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvlegn
eqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisgw
gntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgnsggpv
vcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

Sequence, based on observed residues (ATOM records):

>d3tgke_ b.47.1.2 (E:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvlegn
eqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisgw
gnvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgnsggpvvcnge
lqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

Timeline for d3tgke_:

• d3tgke_ first appeared in SCOP 1.57
  
• d3tgke_ appears in SCOPe 2.06
  
• d3tgke_ appears in the current release, SCOPe 2.08