Lineage for d3cpua1 (3cpu A:404-496)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 170927Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 170928Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 170929Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (14 proteins)
  6. 170945Protein Animal alpha-amylase [51024] (3 species)
  7. 170946Species Human (Homo sapiens) [TaxId:9606] [51026] (16 PDB entries)
  8. 170954Domain d3cpua1: 3cpu A:404-496 [63336]
    Other proteins in same PDB: d3cpua2

Details for d3cpua1

PDB Entry: 3cpu (more details), 2 Å

PDB Description: subsite mapping of the active site of human pancreatic alpha-amylase using substrates, the pharmacological inhibitor acarbose, and an active site variant

SCOP Domain Sequences for d3cpua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cpua1 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens)}
qpftnwydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl

SCOP Domain Coordinates for d3cpua1:

Click to download the PDB-style file with coordinates for d3cpua1.
(The format of our PDB-style files is described here.)

Timeline for d3cpua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cpua2