Lineage for d1qjcb_ (1qjc B:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) 
Family c.26.1.3: Adenylyltransferase [52397] (2 proteins) Protein Phosphopantetheine adenylyltransferase [52398] (1 species) Species Escherichia coli [TaxId:562] [52399] (2 PDB entries) 
Domain d1qjcb_: 1qjc B: [63329]
Details for d1qjcb_
PDB Entry: 1qjc (more details), 1.64 Å
PDB Description: phosphopantetheine adenylyltransferase from escherichia coli in complex with 4'-phosphopantetheine
SCOP Domain Sequences for d1qjcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qjcb_ c.26.1.3 (B:) Phosphopantetheine adenylyltransferase {Escherichia coli}
kraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatahl
gnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmpsk
ewsfissslvkevarhqgdvthflpenvhqalmakla
SCOP Domain Coordinates for d1qjcb_:
Click to download the PDB-style file with coordinates for d1qjcb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qjcb_:
- d1qjcb_ is new in SCOP 1.57
- d1qjcb_ appears in SCOP 1.59
- d1qjcb_ appears in the current release, SCOPe 2.08
View in 3D
