Lineage for d1jxja2 (1jxj A:1-403)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2829862Protein Animal alpha-amylase [51458] (3 species)
    contains Ca2+-binding subdomain, residues 100-170
  7. 2829863Species Human (Homo sapiens) [TaxId:9606] [51460] (55 PDB entries)
    Uniprot P04746 16-511 ! SQ 04746
  8. 2829912Domain d1jxja2: 1jxj A:1-403 [63315]
    Other proteins in same PDB: d1jxja1
    complexed with ca, cl
    has additional subdomain(s) that are not in the common domain

Details for d1jxja2

PDB Entry: 1jxj (more details), 1.99 Å

PDB Description: role of mobile loop in the mechanism of human salivary amylase
PDB Compounds: (A:) Alpha-amylase, salivary

SCOPe Domain Sequences for d1jxja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jxja2 c.1.8.1 (A:1-403) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]}
eyssntqqgrtsivhlfewrwvdialecerylapkgfggvqvsppnenvaihnpfrplwe
ryqpvsyklctrsgnedefrnmvtrcnnvgvriyvdavinhmcgnavsagtsstcgsyfn
pgsrdfpavpysgwdfndgkcktgsgdienyndatqvrdcrlsglldlalgkdyvrskia
eymnhlidigvagfridaskhmwpgdikaildklhnlnsnwfpegskpfiyqevidlgge
pikssdyfgngrvtefkygaklgtvirkwngekmsylknwgegwgfmpsdralvfvdnhd
nqrghgaggasiltfwdarlykmavgfmlahpygftrvmssyrwpryfengkdvndwvgp
pndngvtkevtinpdttcgndwvcehrwrqirnmvnfrnvvdg

SCOPe Domain Coordinates for d1jxja2:

Click to download the PDB-style file with coordinates for d1jxja2.
(The format of our PDB-style files is described here.)

Timeline for d1jxja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jxja1