Lineage for d1jsqh_ (1jsq H:)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 898402Fold i.13: Multidrug resistance ABC transporter [64606] (1 superfamily)
  4. 898403Superfamily i.13.1: Multidrug resistance ABC transporter [64607] (1 family) (S)
  5. 898404Family i.13.1.1: Multidrug resistance ABC transporter [64608] (1 protein)
  6. 898405Protein MsbA [64609] (1 species)
  7. 898406Species Escherichia coli [TaxId:562] [64610] (1 PDB entry)
  8. 898414Domain d1jsqh_: 1jsq H: [63277]

Details for d1jsqh_

PDB Entry: 1jsq (more details), 4.5 Å

PDB Description: structure of msba from escherichia coli: a homolog of the multidrug resistance atp binding cassette (abc) transporters
PDB Compounds: (H:) probable transport ATP-binding protein msba

SCOP Domain Sequences for d1jsqh_:

Sequence, based on SEQRES records: (download)

>d1jsqh_ i.13.1.1 (H:) MsbA {Escherichia coli [TaxId: 562]}
wqtfrrlwptiapfkaglivagvalilnaasdtfmlsllkpllddgfgktdrsvlvwmpl
vviglmilrgitsyvssyciswvsgkvvmtmrrrlfghmmgmpvsffdkqstgtllsrit
ydseqvassssgalitvvregasiiglfimmfyyswqlsiilivlapivsiairvvskrf
rnisknmqntmgqvttsaeqmlkghkevlifggqevetkrfdkvsnrmrlqgmkmvsass
isdpiiqliaslalafvlyaasfpsvmdsltagtitvvfssmialmrplksltnvnaqfq
rgmaacqtlftildseqekdegkrvieratgdvefrnvtftypgrdvpalrninlkipag
ktvalvgrsgsgkstiaslitrfydidegeilmdghdlreytlaslrnqvalvsqnvhlf
ndtvanniayarteqysreqieeaarmayamdfinkmdngldtvigengvllsggqrqri
aiarallrdspilildeatsaldteseraiqaaldelqknrtslviahrlstiekadeiv
vvedgvivergthnd

Sequence, based on observed residues (ATOM records): (download)

>d1jsqh_ i.13.1.1 (H:) MsbA {Escherichia coli [TaxId: 562]}
wqtfrrlwptiapfkaglivagvalilnaasdtfmlsllkpllddgfgktdrsvlvwmpl
vviglmilrgitsyvssyciswvsgkvvmtmrrrlfghmmgmpvsffdkqstgtllsrit
ydseqvassssgalitvvregasiiglfimmfyyswqlsiilivlapivsiairvvskrf
rnisknmqntmgqvttsarlqgmkmvsassisdpiiqliaslalafvlyaasfpsvmdsl
tagtitvvfssmialmrplksltnvnaqfqrgmaacqtlftildseqekdegkrvierat
gdvevalvsqnvhlfndtvanniayarteqysreqieeaarmayamdfinkmdngldtvi
gengvllsggqrqriaiarallrdspilildeatsaldteseraiqaaldelqknrtslv
iahrlstiekadeivvvedgvivergthnd

SCOP Domain Coordinates for d1jsqh_:

Click to download the PDB-style file with coordinates for d1jsqh_.
(The format of our PDB-style files is described here.)

Timeline for d1jsqh_: