SCOP 1.65: Domain d1jsob_: 1jso B:

Lineage for d1jsob_ (1jso B:)

1. Root: SCOP 1.65

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (2 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)

6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (24 PDB entries)

8. Domain d1jsob_: 1jso B: [63269]
   Other proteins in same PDB: d1jsoa_
   complexed with nag, sia

Details for d1jsob_

PDB Entry: 1jso, 2.4 Å

PDB Description: structure of avian h5 haemagglutinin bound to lstc receptor analog

SCOP Domain Sequences for d1jsob_:

Sequence; same for both SEQRES and ATOM records:

>d1jsob_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgttnkvnsiidkmn
tqfeavgkefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydyp

Timeline for d1jsob_:

• d1jsob_ first appeared in SCOP 1.57
  
• d1jsob_ appears in SCOP 1.63
  
• d1jsob_ appears in SCOP 1.67
  
• d1jsob_ appears in the current release, SCOPe 2.08