Lineage for d1jsnb_ (1jsn B:)

  1. Root: SCOP 1.63
  2. 271841Class h: Coiled coil proteins [57942] (6 folds)
  3. 272473Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 272474Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 272475Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 272476Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 272477Species Influenza A virus, different strains [TaxId:11320] [58067] (24 PDB entries)
  8. 272493Domain d1jsnb_: 1jsn B: [63267]
    Other proteins in same PDB: d1jsna_
    complexed with gal, nag, sia

Details for d1jsnb_

PDB Entry: 1jsn (more details), 2.4 Å

PDB Description: structure of avian h5 haemagglutinin complexed with lsta receptro analog

SCOP Domain Sequences for d1jsnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jsnb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgttnkvnsiidkmn
tqfeavgkefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydyp

SCOP Domain Coordinates for d1jsnb_:

Click to download the PDB-style file with coordinates for d1jsnb_.
(The format of our PDB-style files is described here.)

Timeline for d1jsnb_: