Lineage for d1jsmb_ (1jsm B:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2266925Protein Influenza hemagglutinin (stalk) [58066] (12 species)
    trimer
  7. 2266962Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 2266978Domain d1jsmb_: 1jsm B: [63265]
    Other proteins in same PDB: d1jsma_
    complexed with nag

Details for d1jsmb_

PDB Entry: 1jsm (more details), 1.9 Å

PDB Description: structure of h5 avian haemagglutinin
PDB Compounds: (B:) haemagglutinin (ha2 chain)

SCOPe Domain Sequences for d1jsmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jsmb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgttnkvnsiidkmn
tqfeavgkefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydyp

SCOPe Domain Coordinates for d1jsmb_:

Click to download the PDB-style file with coordinates for d1jsmb_.
(The format of our PDB-style files is described here.)

Timeline for d1jsmb_: