SCOP 1.63: Domain d1jshb_: 1jsh B:

Lineage for d1jshb_ (1jsh B:)

1. Root: SCOP 1.63

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)

6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (24 PDB entries)

8. Domain d1jshb_: 1jsh B: [63261]
   Other proteins in same PDB: d1jsha_
   complexed with gal, nag, sia

Details for d1jshb_

PDB Entry: 1jsh, 2.4 Å

PDB Description: crystal structure of h9 haemagglutinin complexed with lsta receptor analog

SCOP Domain Sequences for d1jshb_:

Sequence; same for both SEQRES and ATOM records:

>d1jshb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
glfgaiagfieggwpglvagwygfqhsndqgvgmaadsdstqkaidkitskvnnivdkmn
kqygiidhefseietrlnminnkiddqiqdiwtynaellvllenqktldehdanvnnlyn
kvkralgsnamedgkgcfelyhkcddqcmetirngtynrr

Timeline for d1jshb_:

• d1jshb_ first appeared in SCOP 1.57
  
• d1jshb_ appears in SCOP 1.61
  
• d1jshb_ appears in SCOP 1.65
  
• d1jshb_ appears in the current release, SCOPe 2.08